Item no. |
CSB-EP322527DOS-500 |
Manufacturer |
Cusabio
|
Amount |
500ug |
Quantity options |
1mg
10ug
100ug
20ug
200ug
50ug
500ug
|
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Short name:,PI-3 |
Available |
|
Research Topic |
Others |
Uniprot ID |
P19400 |
Gene Names |
N/A |
Organism |
Ascaris suum (Pig roundworm) (Ascaris lumbricoides) |
AA Sequence |
QFLFSMSTGPFICTVKDNQVFVANLPWTMLEGDDI QVGKEFAARVEDCTNVKHDMAPTCTKPPPFCGPQD MKMFNFVGCSVLGNKLFIDQKYVRDLTAKDHAEVQ TFREKIAAFEEQQENQPPSSGMPHGAVPAGGLSPP PPPSFCTVQ |
Expression Region |
21-169aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
32.4 kDa |
Alternative Name(s) |
Short name: PI-3 |
Relevance |
This is an inhibitor of the aspartic protease pepsin. |
Reference |
"Molecular cloning, expression and characterization of an Ascaris inhibitor for pepsin and cathepsin E."Kageyama T.Eur. J. Biochem. 253:804-809(1998) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
This is an inhibitor of the aspartic protease pepsin. |
Subcellular Location |
Secreted |
Protein Families |
Protease inhibitor I33 family |
Tissue Specificity |
Body wall. |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.