Item no. |
CSB-EP321224BUA-1 |
Manufacturer |
Cusabio
|
Amount |
1mg |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
P.93 |
Available |
|
Research Areas |
Others |
Target / Protein |
prn |
Biologically Active |
Not Test |
Expression System |
E.coli |
Species of origin |
Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) |
Uniprot ID |
P14283 |
AA Sequence |
ALSKRLGELRLNPDAGGAWGRGFAQRQQLDNRAGR RFDQKVAGFELGADHAVAVAGGRWHLGGLAGYTRG DRGFTGDGGGHTDSVHVGGYATYIADSGFYLDATL RASRLENDFKVAGSDGYAVKGKYRTHGVGASLEAG RRFTHADGWFLEPQAELAVFRAGGGAYRAANGLRV RDEGGSSVLGRLGLEVGKRIELAGGRQVQPYIKAS VLQEFDGAGTVHTNGIAHRTELRGTRAELGLGMAA ALGRGHSLYASYEYSKGPKLAMPWTFHAGYRYSW |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Expression Region |
632-910aa |
Protein Length |
Partial |
MW |
45.8 kDa |
Alternative Name(s) |
P.93 |
Relevance |
Agglutinogen that binds to eukaryotic cells; a process mediated by the R-G-D sequence. Pertactin may have a role in bacterial adhesion, and thus play a role in virulence. May contribute to the disease state of whooping cough. |
Reference |
Structure of Bordetella pertussis virulence factor P.69 pertactin.Emsley P., Charles I.G., Fairweather N.F., Isaacs N.W.Nature 381:90-92(1996) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Agglutinogen that binds to eukaryotic cells; a process mediated by the R-G-D sequence. Pertactin may have a role in bacterial adhesion, and thus play a role in virulence. May contribute to the disease state of whooping cough. |
Subcellular Location |
Pertactin autotransporter: Periplasm, SUBCELLULAR LOCATION: Outer membrane protein P69: Secreted, Cell surface, SUBCELLULAR LOCATION: Pertactin translocator: Cell outer membrane, Multi-pass membrane protein |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.