« Back
Home /
Recombinant Escherichia coli Thioredoxin-2(trxC)

Recombinant Escherichia coli Thioredoxin-2(trxC)

Item no.	CSB-EP314858ENV-200
Manufacturer	Cusabio
Amount	200ug
Category	Metabolism Diabetes Cholesterol & Lipid Metabolism Regulation of Appetite Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Protein-disulfide reductase
Available
Research Topic	Others
Uniprot ID	P0AGG4
Gene Names	trxC
Organism	Escherichia coli (strain K12)
AA Sequence	MNTVCTHCQAINRIPDDRIEDAAKCGRCGHDLFDG EVINATGETLDKLLKDDLPVVIDFWAPWCGPCRNF APIFEDVAQERSGKVRFVKVNTEAERELSSRFGIR SIPTIMIFKNGQVVDMLNGAVPKAPFDSWLNESL
Expression Region	1-139aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	31.6 kDa
Alternative Name(s)	Protein-disulfide reductase
Relevance	Efficient electron donor for the essential enzyme ribonucleotide reductase. Is also able to reduce the interchain disulfide bridges of insulin.
Reference	Cloning, expression, and characterization of a novel Escherichia coli thioredoxin.Miranda-Vizuete A., Damdimopoulos A.E., Gustafsson J.-A., Spyrou G.J. Biol. Chem. 272:30841-30847(1997)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Efficient electron donor for the essential enzyme ribonucleotide reductase. Is also able to reduce the interchain disulfide bridges of insulin.
Subcellular Location	Cytoplasm
Protein Families	Thioredoxin family
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time