« Back
Home /
Recombinant Plasmodium berghei L-lactate dehydrogenase(PB000185.00.0)

Recombinant Plasmodium berghei L-lactate dehydrogenase(PB000185.00.0)

Item no.	CSB-EP307560EWN-10
Manufacturer	Cusabio
Amount	10ug
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	Myc
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research areas	Metabolism
Biologically active	Not Test
Expression system	E.coli
Species of origin	Plasmodium berghei (strain Anka)
Uniprot ID	Q7SI97
AA Sequence	MAPKAKIVLVGSGMIGGVMATLIVQKNLGDVVMFD IVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDL KDADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKI MIEIGGHIKNNCPNAFIIVVTNPVDVMVQLLHQHS GVPKNKIVGLGGVLDTSRLKYYISQKLNVCPRDVN AHIVGAHGNKMVLLKRYITVGGIPLQEFINNKKIT DQELDAIFDRTINTALEIVNLHASPYVAPAAAIIE MAESYIRDLRKVLICSTLLEGQYGHKDIFAGTPLV IGGNGVEQVIELQLNADEKKKFDEAVAETSRMKAL
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region	1-316aa
Protein length	Full Length
MW	39.4 kDa
References	"Crystal structure of Plasmodium berghei lactate dehydrogenase indicates the unique structural differences of these enzymes are shared across the Plasmodium genus." Winter V.J., Cameron A., Tranter R., Sessions R.B., Brady R.L. Mol. Biochem. Parasitol. 131:1-10(2003)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Protein Families	LDH/MDH superfamily, LDH family
Tag Information	N-terminal 10xHis-tagged and C-terminal Myc-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time