Item no. |
CSB-EP301675ECY-200 |
Manufacturer |
Cusabio
|
Amount |
200ug |
Quantity options |
1mg
10ug
100ug
20ug
200ug
50ug
500ug
|
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Coat protein C, polypeptide II,G9P |
Available |
|
Research Topic |
Microbiology |
Uniprot ID |
P69538 |
Gene Names |
IX |
Organism |
Enterobacteria phage M13 (Bacteriophage M13) |
AA Sequence |
MSVLVYSFASFVLGWCLRSGITYFTRLMETSS |
Expression Region |
1-32aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
19.7 kDa |
Alternative Name(s) |
Coat protein C, polypeptide II G9P |
Relevance |
May initiate with G7P the virion concomitant assembly-budding process, by interacting with the packaging signal of the viral genome. The assembly-budding takes place at the host inner membrane. In turn, G7P and G9P are present at the end of the filamentous virion that emerges first from the bacterial host. |
Reference |
"Nucleotide sequence of the filamentous bacteriophage M13 DNA genome: comparison with phage fd."van Wezenbeek P.M.G.F., Hulsebos T.J.M., Schoenmakers J.G.G.Gene 11:129-148(1980) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
May initiate with G7P the virion concomitant assembly-budding process, by interacting with the packaging signal of the viral genome. The assembly-budding takes place at the host inner membrane. In turn, G7P and G9P are present at the end of the filamentous virion that emerges first from the bacterial host. |
Subcellular Location |
Virion, Host membrane, Single-pass membrane protein |
Protein Families |
Inovirus G9P protein family |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.