« Back
Home /
Recombinant Human Zinc finger protein 160(ZNF160)

Recombinant Human Zinc finger protein 160(ZNF160)

Item no.	CSB-EP026549HU-100
Manufacturer	Cusabio
Amount	100ug
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Testicular & Prostate Cancer
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	Myc
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Zinc finger protein HZF5,Zinc finger protein Kr18,Short name:,HKr18
Available
Research Areas	Epigenetics and Nuclear Signaling
Uniprot ID	Q9HCG1
Gene Names	ZNF160
Organism	Homo sapiens (Human)
AA Sequence	MALTQVRLTFRDVAIEFSQEEWKCLDPAQRILYRD VMLENYWNLVSLGLCHFDMNIISMLEEGKEPWTVK SCVKIARKPRTPECVKGVVTDLLRRWKHWLLLLGI CCPKPHGRVSSRLRLSRSLGHFFHSAFATFMGVCD KRVGSIF
Expression Region	1-147aa
Sequence Info	Full Length of Isoform 2
Source	E.coli
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW	22.1 kDa
Alternative Name(s)	Zinc finger protein HZF5 Zinc finger protein Kr18 Short name: HKr18
Relevance	May be involved in transcriptional regulation.
Reference	The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).The MGC Project Team Genome Res. 14:2121-2127(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May be involved in transcriptional regulation.
Subcellular Location	Nucleus
Protein Families	Krueppel C2H2-type zinc-finger protein family
Tissue Specificity	Ubiquitous.
Tag Information	N-terminal 10xHis-tagged and C-terminal Myc-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Request delivery time