Item no. |
CSB-EP025577HU-1 |
Manufacturer |
Cusabio
|
Amount |
1mg |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
UDPGT 1-4,Short name:,UGT1*4,Short name:,UGT1-04,Short name:,UGT1.4,Alternative name(s):,Bilirubin-specific UDPGT isozyme 2,Short name:,hUG-BR2,UDP-glucuronosyltransferase 1-D,Short name:,UGT-1D,Short name:,UGT1D,UDP-glucuronosyltransferase 1A4 |
Available |
|
Research Areas |
Signal Transduction |
Uniprot ID |
P22310 |
Gene Names |
UGT1A4 |
Organism |
Homo sapiens (Human) |
AA Sequence |
GKVLVVPTDGSPWLSMREALRELHARGHQAVVLTP EVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQ GFFETEHLLKRYSRSMAIMNNVSLALHRCCVELLH NEALIRHLNATSFDVVLTDPVNLCGAVLAKYLSIP AVFFWRYIPCDLDFKGTQCPNPSSYIPKLLTTNSD HMTFLQRVKNMLYPLALSYICHTFSAPYASLASEL FQREVSVVDLVSYASVWLFRGDFVMDYPRPIMPNM VFIGGINCANGKPLSQEFEAYINASGEHGIVVFSL GSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRP SNLANNTILVKWLPQNDLLGHPMTRAFITHAGSHG VYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVT LNVLEMTSEDLENALKAVINDKSYKENIMRLSSLH KDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLT WYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKC LGKKGRVKKAHKSKTH |
Expression Region |
29-534aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
61 kDa |
Alternative Name(s) |
UDPGT 1-4 Short name: UGT1*4 Short name: UGT1-04 Short name: UGT1.4 Alternative name(s): Bilirubin-specific UDPGT isozyme 2 Short name: hUG-BR2 UDP-glucuronosyltransferase 1-D Short name: UGT-1D Short name: UGT1D UDP-glucuronosyltransferase 1A4 |
Relevance |
UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isoform glucuronidates bilirubin IX-alpha to form both the IX-alpha-C8 and IX-alpha-C12 monoconjugates and diconjugate. Isoform 2 lacks transferase activity but acts as a negative regulator of isoform 1 (By similarity). |
Reference |
Molecular pathogenesis of Gilbert's syndrome: decreased TATA-binding protein binding affinity of UGT1A1 gene promoter.Hsieh T.Y., Shiu T.Y., Huang S.M., Lin H.H., Lee T.C., Chen P.J., Chu H.C., Chang W.K., Jeng K.S., Lai M.M., Chao Y.C.Pharmacogenet. Genomics 17:229-236(2007) . |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isoform glucuronidates bilirubin IX-alpha to form both the IX-alpha-C8 and IX-alpha-C12 monoconjugates and diconjugate. Isoform 2 lacks transferase activity but acts as a negative regulator of isoform 1 (By similarity). |
Involvement in disease |
Gilbert syndrome (GILBS); Crigler-Najjar syndrome 1 (CN1); Crigler-Najjar syndrome 2 (CN2) |
Subcellular Location |
Microsome, Endoplasmic reticulum membrane, Single-pass membrane protein |
Protein Families |
UDP-glycosyltransferase family |
Tissue Specificity |
Isoform 1 and isoform 2 are expressed in liver, kidney, colon and small intestine. Isoform 2 but not isoform 1 is expressed in esophagus. Not expressed in skin. |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.