Item no. |
CSB-EP024405MO-1 |
Manufacturer |
Cusabio
|
Amount |
1mg |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Short name:,TREM-2,Alternative name(s):,Triggering receptor expressed on monocytes 2 |
Available |
|
Research Areas |
Immunology |
Uniprot ID |
Q99NH8 |
Gene Names |
Trem2 |
Organism |
Mus musculus (Mouse) |
AA Sequence |
LNTTVLQGMAGQSLRVSCTYDALKHWGRRKAWCRQ LGEEGPCQRVVSTHGVWLLAFLKKRNGSTVIADDT LAGTVTITLKNLQAGDAGLYQCQSLRGREAEVLQK VLVEVLEDPLDDQDAGDLWVPEESSSFEGAQVEHS TSRNQETSFPPTS |
Expression Region |
19-171aa |
Sequence Info |
Extracellular Domain |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
20.8 kDa |
Alternative Name(s) |
Short name: TREM-2 Alternative name(s): Triggering receptor expressed on monocytes 2 |
Relevance |
May have a role in chronic inflammations and may stimulate production of constitutive rather than inflammatory chemokines and cytokines. Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells. |
Reference |
Cloning and characterization of a novel mouse myeloid DAP12-associated receptor family.Daws M.R., Lanier L.L., Seaman W.E., Ryan J.C. Eur. J. Immunol. 31:783-791(2001) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells. May have a role in chronic inflammations and may stimulate production of constitutive rather than inflammatory chemokines and cytokines. |
Subcellular Location |
Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Secreted |
Tissue Specificity |
Expressed at higher levels in the CNS, heart and lung than in lymph nodes or in other non-lymphoid tissues such as kidney, liver and testis. In the CNS not all microglia express TREM2. Brain regions with an incomplete blood-brain barrier had the lowest percentages of TREM2 expressing microglia, whereas the lateral entorhinal and cingulate cortex had the highest percentages. |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.