« Back
Home /
Recombinant Human Triggering receptor expressed on myeloid cells 2(TREM2),partial

Recombinant Human Triggering receptor expressed on myeloid cells 2(TREM2),partial

Item no.	CSB-EP024405HU-100
Manufacturer	Cusabio
Amount	100ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Triggering receptor expressed on monocytes 2
Available
Research Areas	Immunology
Uniprot ID	Q9NZC2
Gene Names	TREM2
Organism	Homo sapiens (Human)
AA Sequence	HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQ LGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDT LGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRK VLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHS ISRSLLEGEIPFPPTS
Expression Region	19-174aa
Sequence Info	Extracellular Domain
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	21.4 kDa
Alternative Name(s)	Triggering receptor expressed on monocytes 2
Relevance	May have a role in chronic inflammations and may stimulate production of constitutive rather than inflammatory chemokines and cytokines. Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells.
Reference	Inflammatory responses can be triggered by TREM-1, a novel receptor expressed on neutrophils and monocytes.Bouchon A., Dietrich J., Colonna M.J. Immunol. 164:4991-4995(2000)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells. May have a role in chronic inflammations and may stimulate production of constitutive rather than inflammatory chemokines and cytokines.
Involvement in disease	Polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL)
Subcellular Location	Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Secreted, SUBCELLULAR LOCATION: Isoform 3: Secreted
Tissue Specificity	Expressed on macrophages and dendritic cells but not on granulocytes or monocytes. In the CNS strongest expression seen in the basal ganglia, corpus callosum, medulla oblongata and spinal cord.
Paythway	Osteoclastdifferentiation
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP024405HU-100-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Request delivery time