« Back
Home /
Recombinant Human Tumor necrosis factor receptor superfamily member 1B(TNFRSF1B),partial

Recombinant Human Tumor necrosis factor receptor superfamily member 1B(TNFRSF1B),partial

Item no.	CSB-EP023978HU-1
Manufacturer	Cusabio
Amount	1mg
Category	Neuroscience Metabolism Diabetes Glucose Homeostasis Targets for Rodent Neurosciences Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Host	E.coli
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Tumor necrosis factor receptor 2 ;TNF-R2Tumor necrosis factor receptor type II ;TNF-RII ;TNFR-IIp75p80 TNF-alpha receptor; CD120bINN: Etanercept
Available
Alternative Name(s)	Tumor necrosis factor receptor 2 ; TNF-R2Tumor necrosis factor receptor type II ; TNF-RII ; TNFR-IIp75p80 TNF-alpha receptor; CD120bINN: Etanercept
AA Sequence	VAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQ HAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSC GSRCSSDQVETQACTREQNRICTCRPGWYCALSKQ EGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAP GTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCT ST
Research Topic	Cell Biology
Uniprot ID	P20333
Gene Names	TNFRSF1B
Tag Info	N-terminal GST-tagged
Expression Region	27-203aa
MW of Fusion Proten	46, 3
Sequence Info	Partial
Relevance	Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity.
Reference	A second tumor necrosis factor receptor gene product can shed a naturally occurring tumor necrosis factor inhibitor.Kohno T., Brewer M.T., Baker S.L., Schwartz P.E., King M.W., Hale K.K., Squires C.H., Thompson R.C., Vannice J.L.Proc. Natl. Acad. Sci. U.S.A. 87:8331-8335(1990)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species	Homo sapiens (Human)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time