Item no. |
CSB-EP023951HU-10 |
Manufacturer |
Cusabio
|
Amount |
10ug |
Quantity options |
1mg
10ug
100ug
20ug
200ug
50ug
500ug
|
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Conjugate/Tag |
GST |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Cell proliferation-inducing gene 26 protein,Thioredoxin domain-containing protein 14 |
Available |
|
Research Topic |
Cell Biology |
Uniprot ID |
Q9Y320 |
Gene Names |
TMX2 |
Organism |
Homo sapiens (Human) |
AA Sequence |
LPTQREDGNPCDFDWREVEILMFLSAIVMMKNRRS ITVEQHIGNIFMFSKVANT |
Expression Region |
49-102aa |
Sequence Info |
Extracellular Domain |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
33.3 kDa |
Alternative Name(s) |
Cell proliferation-inducing gene 26 protein Thioredoxin domain-containing protein 14 |
Reference |
"Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics."Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C.Genome Res. 10:703-713(2000) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Subcellular Location |
Membrane, Single-pass type I membrane protein |
Tissue Specificity |
Widely expressed. |
Tag Information |
N-terminal GST-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.