Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
1mg |
Host |
E.coli |
Item no. |
CSB-EP023601HU1-1 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Alias |
Toll/interleukin-1 receptor-like protein 4; CD282 |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Research Areas |
Immunology |
Uniprot ID |
O60603 |
Gene Names |
TLR2 |
Organism |
Homo sapiens (Human) |
AA Sequence |
KEESSNQASLSCDRNGICKGSSGSLNSIPSGLTEA VKSLDLSNNRITYISNSDLQRCVNLQALVLTSNGI NTIEEDSFSSLGSLEHLDLSYNYLSNLSSSWFKPL SSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGN MDTFTKIQRKDFAGLTFLEELEIDASDLQSYEPKS LKSIQNVSHLILHMKQHILLLEIFVDVTSSVECLE LRDTDLDTFHFSELSTGETNSLIKKFTFRNVKITD ESLFQVMKLLNQISGLLELEFDDCTLNGVGNFRAS DNDRVIDPGKVETLTIRRLHIPRFYLFYDLSTLYS LTERVKRITVENSKVFLVPCLLSQHLKSLEYLDLS ENLMVEEYLKNSACEDAWPSLQTLILRQNHLASLE KTGETLLTLKNLTNIDISKNSFHSMPETCQWPEKM KYLNLSSTRIHSVTGCIPKTLEILDVSNNNLNLFS LNLPQLKELYISRNKLMTLPDASLLPMLLVLKISR NAITTFSKEQLDSFHTLKTLEAGGNNFICSCEFLS FTQEQQALAKVLIDWPANYLCDSPSHVRGQQVQDV RLSVSECHRT |
Expression Region |
19-588aa |
Sequence Info |
Extracellular Domain |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
80.4 kDa |
Alternative Name(s) |
Toll/interleukin-1 receptor-like protein 4; CD282 |
Relevance |
Cooperates with LY96 to mediate the innate immune response to bacterial lipoproteins and other microbial cell wall components. Cooperates with TLR1 or TLR6 to mediate the innate immune response to bacterial lipoproteins or lipopeptides. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. May also promote apoptosis in response to lipoproteins. Recognizes mycoplasmal macrophage-activating lipopeptide-2kD (MALP-2), soluble tuberculosis factor (STF), phenol-soluble modulin (PSM) and B.burgdorferi outer surface protein A lipoprotein (OspA-L) cooperatively with TLR6. |
Reference |
A family of human receptors structurally related to Drosophila Toll.Rock F.L., Hardiman G., Timans J.C., Kastelein R.A., Bazan J.F.Proc. Natl. Acad. Sci. U.S.A. 95:588-593(1998) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Cooperates with LY96 to mediate the innate immune response to bacterial lipoproteins and other microbial cell wall components. Cooperates with TLR1 or TLR6 to mediate the innate immune response to bacterial lipoproteins or lipopeptides |
Subcellular Location |
Membrane, Single-pass type I membrane protein, Cytoplasmic vesicle, phagosome membrane, Single-pass type I membrane protein, Membrane raft |
Protein Families |
Toll-like receptor family |
Tissue Specificity |
Highly expressed in peripheral blood leukocytes, in particular in monocytes, in bone marrow, lymph node and in spleen. Also detected in lung and in fetal liver. Levels are low in other tissues. |
Paythway |
PI3K-Aktsignalingpathway |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.