« Back
Home /
Recombinant Mouse Thrombospondin-1(Thbs1)?partial

Recombinant Mouse Thrombospondin-1(Thbs1)?partial

Manufacturer	Cusabio
Category	Neuroscience Neuroinflammation Molecular Targets for Neuroscience Aging & Neurological Disorders Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	10ug
Host	E.coli
Item no.	CSB-EP023487MO-10
eClass 6.1	34160400
eClass 9.0	42020190
Available
Purity	Greater than 90% as determined by SDS-PAGE.
Research areas	Others
Target / Protein	Thbs1
Biologically active	Not Test
Expression system	E.coli
Species of origin	Mus musculus (Mouse)
Uniprot ID	Q80YQ1
AA Sequence	NRIPESGGDNGVFDIFELIGGARRGPGRRLVKGQD LSSPAFRIENANLIPAVPDDKFQDLLDAVWADKGF IFLASLRQMKKTRGTLLAVERKDNTGQIFSVVSNG KAGTLDLSLSLPGKQQVVSVEEALLATGQWKSITL FVQEDRAQLYIDCDKMESAELDVPIQSIFTRDLAS VARLRVAKGDVNDNFQGVLQNVRFVFGTTPEDILR NKGCSSSATNVLLTLDNNVVNGSSPAIRTNYIGHK TKDLQAICGLSCDELSSMVLELKGLRTIVTTLQDS IRKVTEENRELVSELKRPPLCFHNGVQYKNNEEWT VDSCTECHCQNSVTICK
Tag Info	N-terminal 6xHis-tagged
Expression Region	19-350aa
Protein length	Full Length of Mature Protein
MW	40.6 kDa
Relevance	Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. Binds heparin. May play a role in dentinogenesis and/or maintenance of dentin and dental pulp. Ligand for CD36 mediating antiangiogenic properties . Plays a role in ER stress response, via its interaction with the activating transcription factor 6 alpha (ATF6) which produces adaptive ER stress response factors.1 Publication
References	A thrombospondin-dependent pathway for a protective ER stress response.Lynch J.M., Maillet M., Vanhoutte D., Schloemer A., Sargent M.A., Blair N.S., Lynch K.A., Okada T., Aronow B.J., Osinska H., Prywes R., Lorenz J.N., Mori K., Lawler J., Robbins J., Molkentin J.D.Cell 149:1257-1268(2012)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP023487MO-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time