Item no. |
CSB-EP021338HU-1 |
Manufacturer |
Cusabio
|
Amount |
1mg |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
CD172 antigen-like family member B,Signal-regulatory protein beta-2,Short name:,SIRP-b2,Short name:,SIRP-beta-2,CD_antigen: CD172g |
Available |
|
Research Areas |
Immunology |
Uniprot ID |
Q9P1W8 |
Gene Names |
SIRPG |
Organism |
Homo sapiens (Human) |
AA Sequence |
EEELQMIQPEKLLLVTVGKTATLHCTVTSLLPVGP VLWFRGVGPGRELIYNQKEGHFPRVTTVSDLTKRN NMDFSIRISSITPADVGTYYCVKFRKGSPENVEFK SGPGTEMALGAKPSAPVVLGPAARTTPEHTVSFTC ESHGFSPRDITLKWFKNGNELSDFQTNVDPTGQSV AYSIRSTARVVLDPWDVRSQVICEVAHVTLQGDPL RGTANLSEAIRVPPTLEVTQQPMRVGNQVNVTCQV RKFYPQSLQLTWSENGNVCQRETASTLTENKDGTY NWTSWFLVNISDQRDDVVLTCQVKHDGQLAVSKRL ALEVTVHQKDQSSDATP |
Expression Region |
29-360aa |
Sequence Info |
Extracellular Domain |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
40.8 kDa |
Alternative Name(s) |
CD172 antigen-like family member B Signal-regulatory protein beta-2 Short name: SIRP-b2 Short name: SIRP-beta-2 CD_antigen: CD172g |
Relevance |
Probable immunoglobulin-like cell surface receptor. On binding with CD47, mediates cell-cell adhesion. Engagement on T-cells by CD47 on antigen-presenting cells results in enhanced antigen-specific T-cell proliferation and costimulates T-cell activation. |
Reference |
Molecular cloning of a novel human gene (SIRP-B2) which encodes a new member of the SIRP/SHPS-1 protein family.Ichigotani Y., Matsuda S., Machida K., Oshima K., Iwamoto T., Yamaki K., Hayakawa T., Hamaguchi M.J. Hum. Genet. 45:378-382(2000) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Probable immunoglobulin-like cell surface receptor. On binding with CD47, mediates cell-cell adhesion. Engagement on T-cells by CD47 on antigen-presenting cells results in enhanced antigen-specific T-cell proliferation and costimulates T-cell activation. |
Subcellular Location |
Membrane, Single-pass type I membrane protein |
Tissue Specificity |
Detected in liver, and at very low levels in brain, heart, lung, pancreas, kidney, placenta and skeletal muscle. Expressed on CD4+ T-cells, CD8+ T-cells, CD56-bright natural killer (NK) cells, CD20+ cells, and all activated NK cells. Mainly present in the paracortical T-cell area of lymph nodes, with only sparse positive cells in the mantle and in the germinal center of B-cell follicles. In the thymus, primarily expressed in the medulla on mature T-lymphocytes that have undergone thymic selection. |
Paythway |
Osteoclastdifferentiation |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.