Comparison

Recombinant Human Surfactant-associated protein 3(SFTA3)

Item no. CSB-EP021167HU-200
Manufacturer Cusabio
Amount 200ug
Quantity options 1mg 10ug 100ug 20ug 200ug 50ug 500ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Purity Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Surfactant-associated protein H ;SP-H
Available
Research Topic
Cell Biology
Uniprot ID
P0C7M3
Gene Names
SFTA3
Organism
Homo sapiens (Human)
AA Sequence
MRAGFSDFQLIRDQVLFLQDQAQRLTEWLQLSGFE NPVSESTTLCLREREKRIPTCVAVCVPSPGTVHTA LLHPTTLSQSRSSSEAKMLIIHTA
Expression Region
1-94aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal 6xHis-tagged
MW
14.5 kDa
Alternative Name(s)
Surfactant-associated protein H ; SP-H
Reference
The DNA sequence and analysis of human chromosome 14.Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.Nature 421:601-607(2003)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Subcellular Location
Cytoplasm, Secreted
Tissue Specificity
Found (at protein level) in lung alveolar cells type I and II, as well as alveolar macrophages.
Tag Information
N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close