« Back
Home /
Recombinant Mouse S-arrestin(Sag)

Recombinant Mouse S-arrestin(Sag)

Item no.	CSB-EP020669MOa0-200
Manufacturer	Cusabio
Amount	200ug
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Topic	Signal Transduction
Uniprot ID	P20443
Gene Names	Sag
Organism	Mus musculus (Mouse)
AA Sequence	MAACGKTNKSHVIFKKVSRDKSVTIYLGKRDYVDH VSQVEPVDGVVLVDPELVKGKKVYVTLTCAFRYGQ EDIDVMGLTFRRDLYFSRVQVYPPVGAMSVLTQLQ ESLLKKLGDNTYPFLLTFPDYLPCSVMLQPAPQDV GKSCGVDFEVKAFASDITDPEEDKIPKKSSVRLLI RKVQHAPPEMGPQPSAEASWQFFMSDKPLNLSVSL SKEIYFHGEPIPVTVTVTNNTDKVVKKIKVSVEQI ANVVLYSSDYYVKPVASEETQEKVQPNSTLTKTLV LVPLLANNRERRGIALDGKIKHEDTNLASSTIIKE GIDRTVMGILVSYHIKVKLTVSGFLGELTSSEVAT EVPFRLMHPQPEDPAKESVQDENLVFEEFARQNLK DTGENTEGKKDEDAGQDE
Expression Region	1-403aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	50.4 kDa
Alternative Name(s)	48 kDa protein (Retinal S-antigen) (S-AG) (Rod photoreceptor arrestin)
Relevance	Binds to photoactivated, phosphorylated RHO and terminates RHO signaling via G-proteins by competing with G-proteins for the same binding site on RHO. May play a role in preventing light-dependent degeneration of retinal photoreceptor cells
Reference	"Deactivation of phosphorylated and nonphosphorylated rhodopsin by arrestin splice variants." Burns M.E., Mendez A., Chen C.K., Almuete A., Quillinan N., Simon M.I., Baylor D.A., Chen J. J. Neurosci. 26:1036-1044(2006)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Binds to photoactivated, phosphorylated RHO and terminates RHO signaling via G-proteins by competing with G-proteins for the same binding site on RHO
Subcellular Location	Cell projection, cilium, photoreceptor outer segment, Membrane, Peripheral membrane protein
Protein Families	Arrestin family
Tissue Specificity	Detected in retina (at protein level).
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time