Item no. |
CSB-EP020656HOb0-100 |
Manufacturer |
Cusabio
|
Amount |
100ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Available |
|
Research areas |
Cardiovascular |
Target / Protein |
SAA1 |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Equus caballus (Horse) |
Uniprot ID |
P19857 |
AA Sequence |
LLSFLGEAARGTWDMIRAYNDMREANYIGADKYFH ARGNYDAAKRGPGGAWAAKVISDARENFQRFTDRF SFGGSGRGAEDSRADQAANEWGRSGKDPNHFRPHG LPDKY |
Tag Info |
N-terminal 10xHis-tagged |
Expression Region |
1-110aa |
Protein length |
Full Length |
MW |
15.8 kDa |
Alternative Name(s) |
Amyloid fibril protein AA |
Relevance |
Major acute phase reactant. Apolipoprotein of the HDL complex. |
References |
The amino acid sequence of an amyloid fibril protein AA isolated from the horse.Sletten K., Husebekk A., Husby G.Scand. J. Immunol. 26:79-84(1987) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Major acute phase reactant. Apolipoprotein of the HDL complex. |
Involvement in disease |
Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA protein. These deposits are highly insoluble and resistant to proteolysis; they disrupt tissue structure and compromise function. |
Protein Families |
SAA family |
Tissue Specificity |
Expressed by the liver; secreted in plasma. |
Tag Information |
N-terminal 10xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.