Item no. |
CSB-EP020076HU-10 |
Manufacturer |
Cusabio
|
Amount |
10ug |
Quantity options |
1mg
10ug
100ug
20ug
200ug
50ug
500ug
|
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Conjugate/Tag |
GST |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Available |
|
Research Topic |
Neuroscience |
Uniprot ID |
O75695 |
Gene Names |
RP2 |
Organism |
Homo sapiens (Human) |
AA Sequence |
GCFFSKRRKADKESRPENEEERPKQYSWDQREKVD PKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCN IYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCR DCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSS NIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHD FTPVSGELNWSLLPEDAVVQDYVPIPTTEELKAVR VSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYT IANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVF REKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVN EIFNGTKMFVSESKETASGDVDSFYNFADIQMGI |
Expression Region |
1-350aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
66.5 kDa |
Relevance |
Acts as a GTPase-activating protein (GAP) involved in trafficking between the Golgi and the ciliary membrane. Involved in localization of proteins, such as NPHP3, to the cilium membrane by inducing hydrolysis of GTP ARL3, leading to the release of UNC119 (or UNC119B). Acts as a GTPase-activating protein (GAP) for tubulin in concert with tubulin-specific chaperone C, but does not enhance tubulin heterodimerization. Acts as guanine nucleotide dissociation inhibitor towards ADP-ribosylation factor-like proteins. |
Reference |
"Positional cloning of the gene for X-linked retinitis pigmentosa 2." Schwahn U., Lenzner S., Dong J., Feil S., Hinzmann B., van Duijnhoven G., Kirschner R., Hemberger M., Bergen A.A.B., Rosenberg T., Pinckers A.J.L.G., Fundele R., Rosenthal A., Cremers F.P.M., Ropers H.-H., Berger W. Nat. Genet. 19:327-332(1998) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Acts as a GTPase-activating protein (GAP) involved in trafficking between the Golgi and the ciliary membrane. Involved in localization of proteins, such as NPHP3, to the cilium membrane by inducing hydrolysis of GTP ARL3, leading to the release of UNC119 (or UNC119B). Acts as a GTPase-activating protein (GAP) for tubulin in concert with tubulin-specific chaperone C, but does not enhance tubulin heterodimerization. Acts as guanine nucleotide dissociation inhibitor towards ADP-ribosylation factor-like proteins. |
Involvement in disease |
Retinitis pigmentosa 2 (RP2) |
Subcellular Location |
Cell membrane, Lipid-anchor, Cytoplasmic side, Cell projection, cilium |
Protein Families |
TBCC family |
Tissue Specificity |
Ubiquitous. Expressed in the rod and cone photoreceptors, extending from the tips of the outer segment (OS) through the inner segment (IS) and outer nuclear layer (ONL) and into the synaptic terminals of the outer plexiform layer (ONL). Also detected in the bipolar, horizontal and amacrine cells in the inner nuclear layer (INL), extending to the inner plexiform layer (IPL) and though the ganglion cell layer (GCL) and into the nerve fiber layer (NFL) (at protein level). |
Tag Information |
N-terminal GST-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.