Item no. |
CSB-EP019327HU-500 |
Manufacturer |
Cusabio
|
Amount |
500ug |
Quantity options |
1mg
10ug
100ug
20ug
200ug
50ug
500ug
|
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Conjugate/Tag |
GST |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Available |
|
Research Topic |
Signal Transduction |
Uniprot ID |
P61225 |
Gene Names |
RAP2B |
Organism |
Homo sapiens (Human) |
AA Sequence |
MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPT IEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDL YIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKR YERVPMILVGNKVDLEGEREVSYGEGKALAEEWSC PFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEG CCSAC |
Expression Region |
1-183aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
47.2 kDa |
Relevance |
Small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. Involved in EGFR and CHRM3 signaling pathways through stimulation of PLCE1. May play a role in cytoskeletal rearrangements and regulate cell spreading through activation of the effector TNIK. May regulate membrane vesiculation in red blood cells. |
Reference |
"RAP2B: a RAS-related GTP-binding protein from platelets." Ohmstede C.A., Farrell F.X., Reep B.R., Clemetson K.J., Lapetina E.G. Proc. Natl. Acad. Sci. U.S.A. 87:6527-6531(1990) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. Involved in EGFR and CHRM3 signaling pathways through stimulation of PLCE1. May play a role in cytoskeletal rearrangements and regulate cell spreading through activation of the effector TNIK. May regulate membrane vesiculation in red blood cells. |
Subcellular Location |
Recycling endosome membrane, Lipid-anchor, Cytoplasmic side |
Protein Families |
Small GTPase superfamily, Ras family |
Tissue Specificity |
Expressed in red blood cells (at protein level). |
Tag Information |
N-terminal GST-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.