Item no. |
CSB-EP018424MO-50 |
Manufacturer |
Cusabio
|
Amount |
50ug |
Quantity options |
1mg
10ug
100ug
20ug
200ug
50ug
500ug
|
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Purity |
Greater than 85% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Available |
|
Research Topic |
Epigenetics and Nuclear Signaling |
Uniprot ID |
P37238 |
Gene Names |
Pparg |
Organism |
Mus musculus (Mouse) |
AA Sequence |
MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTE MPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDF SSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSA IKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECR VCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDR CDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRF GRMPQAEKEKLLAEISSDIDQLNPESADLRALAKH LYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDM NSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQF RSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGV HEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLR KPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPE SSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETD MSLHPLLQEIYKDLY |
Expression Region |
1-505aa |
Sequence Info |
Full Length of Isoform 2 |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
73.6 kDa |
Alternative Name(s) |
Nuclear receptor subfamily 1 group C member 3 |
Relevance |
Nuclear receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Once activated by a ligand, the nuclear receptor binds to DNA specific PPAR response elements (PPRE) and modulates the transcription of its target genes, such as acyl-CoA oxidase. It therefore controls the peroxisomal beta-oxidation pathway of fatty acids. Key regulator of adipocyte differentiation and glucose homeostasis. ARF6 acts as a key regulator of the tissue-specific adipocyte P2 (aP2) enhancer. Acts as a critical regulator of gut homeostasis by suppressing NF-kappa-B-mediated proinflammatory responses. Plays a role in the regulation of cardiovascular circadian rhythms by regulating the transcription of ARNTL/BMAL1 in the blood vessels |
Reference |
"Differential expression and activation of a family of murine peroxisome proliferator-activated receptors." Kliewer S.A., Forman B.M., Blumberg B., Ong E.S., Borgmeyer U., Mangelsdorf D.J., Umesono K., Evans R.M. Proc. Natl. Acad. Sci. U.S.A. 91:7355-7359(1994) |
Purity |
Greater than 85% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Nuclear receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Once activated by a ligand, the nuclear receptor binds to DNA specific PPAR response elements (PPRE) and modulates the transcription of its target genes, such as acyl-CoA oxidase. It therefore controls the peroxisomal beta-oxidation pathway of fatty acids. Key regulator of adipocyte differentiation and glucose homeostasis. ARF6 acts as a key regulator of the tissue-specific adipocyte P2 (aP2) enhancer. Acts as a critical regulator of gut homeostasis by suppressing NF-kappa-B-mediated proinflammatory responses. Plays a role in the regulation of cardiovascular circadian rhythms by regulating the transcription of ARNTL/BMAL1 in the blood vessels |
Subcellular Location |
Nucleus, Cytoplasm |
Protein Families |
Nuclear hormone receptor family, NR1 subfamily |
Tissue Specificity |
Highest expression in white and brown adipose tissue. Also found in liver, skeletal muscle, heart, adrenal gland, spleen, kidney and intestine. Isoform 2 is more abundant than isoform 1 in adipose tissue. |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.