Item no. |
CSB-EP017900HU-100 |
Manufacturer |
Cusabio
|
Amount |
100ug |
Quantity options |
1mg
10ug
100ug
20ug
200ug
50ug
500ug
|
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Conjugate/Tag |
GST |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
BRCA1 C-terminus-associated protein,Renal carcinoma antigen NY-REN-34 |
Available |
|
Research Areas |
Epigenetics and Nuclear Signaling |
Uniprot ID |
Q9UIL8 |
Gene Names |
PHF11 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MEKRTCALCPKDVEYNVLYFAQSENIAAHENCLLY SSGLVECEDQDPLNPDRSFDVESVKKEIQRGRKLK CKFCHKRGATVGCDLKNCNKNYHFFCAKKDDAVPQ SDGVRGIYKLLCQQHAQFPIIAQSAKFSGVKRKRG RKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDA TVKVPFLKKCKEAGLLNYLLEEILDKVHSIPEKLM DETTSESDYEEIGSALFDCRLFEDTFVNFQAAIEK KIHASQQRWQQLKEEIELLQDLKQTLCSFQENRDL MSSSTSISSLSY |
Expression Region |
1-292aa |
Sequence Info |
Full Length of Isoform 2 |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
60.5 kDa |
Alternative Name(s) |
BRCA1 C-terminus-associated protein Renal carcinoma antigen NY-REN-34 |
Relevance |
Positive regulator of Th1-type cytokine gene expression. |
Reference |
Antigens recognized by autologous antibody in patients with renal-cell carcinoma. Scanlan M.J., Gordan J.D., Williamson B., Stockert E., Bander N.H., Jongeneel C.V., Gure A.O., Jaeger D., Jaeger E., Knuth A., Chen Y.-T., Old L.J. Int. J. Cancer 83:456-464(1999) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Positive regulator of Th1-type cytokine gene expression. |
Subcellular Location |
Nucleus |
Tissue Specificity |
Highly expressed in T and B-cells, as well as natural killer and mature dendritic cells. Expressed at higher levels in Th1 as compared to Th2 cells. Expressed at low levels in all normal tissues tested, including lung, testis, small intestine, breast, liver and placenta. |
Tag Information |
N-terminal GST-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.