Item no. |
CSB-EP017260HU(F)-50 |
Manufacturer |
Cusabio
|
Amount |
50ug |
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Host |
E.coli |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Short name:OSM |
Available |
|
Target / Protein |
OSM |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Homo sapiens (Human) |
Uniprot ID |
P13725 |
AA Sequence |
AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYI RIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGF LQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNI EDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEP TKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHR FMHSVGRVFSKWGESPNRSRR |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Expression Region |
26-221aa |
Protein length |
Full Length of Mature Protein |
MW |
38.2 kDa |
Alternative Name(s) |
Short name:OSM |
Relevance |
Growth regulator. Inhibits the proliferation of a number of tumor cell lines. Stimulates proliferation of AIDS-KS cells. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses both type I OSM receptor (heterodimers composed of LIPR and IL6ST) and type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration |
References |
"Molecular cloning, sequence analysis, and functional expression of a novel growth regulator, oncostatin M."Malik N., Kallestad J.C., Gunderson N.L., Austin S.D., Neubauer M.G., Ochs V., Marquardt H., Zarling J.M., Shoyab M., Wei C.M., Linsley P.S., Rose T.M.Mol. Cell. Biol. 9:2847-2853(1989) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Growth regulator. Inhibits the proliferation of a number of tumor cell lines. Stimulates proliferation of AIDS-KS cells. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses both type I OSM receptor (heterodimers composed of LIPR and IL6ST) and type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration (By similarity). |
Subcellular Location |
Secreted |
Protein Families |
LIF/OSM family |
Paythway |
Jak-STATsignalingpathway |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.