Item no. |
CSB-EP016264MO-50 |
Manufacturer |
Cusabio
|
Amount |
50ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Parvalbumin beta |
Available |
|
Research areas |
Neuroscience |
Target / Protein |
Ocm |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Mus musculus (Mouse) |
Uniprot ID |
P51879 |
AA Sequence |
SITDILSADDIAAALQECQDPDTFEPQKFFQTSGL SKMSASQLKDIFQFIDNDQSGYLDEDELKYFLQRF QSDARELTESETKSLMDAADNDGDGKIGADEFQEM VHS |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Expression Region |
2-109aa |
Protein length |
Full Length of Mature Protein |
MW |
28.1 kDa |
Alternative Name(s) |
Parvalbumin beta |
Relevance |
Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions. |
References |
"The intracisternal A particle derived solo LTR promoter of the rat oncomodulin gene is not present in the mouse gene."Banville D., Rotaru M., Boie Y.Genetica 86:85-97(1992) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions. |
Protein Families |
Parvalbumin family |
Tissue Specificity |
Found in tumor tissues and not detected in normal tissues. |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.