« Back
Home /
Recombinant Human NF-kappa-B-repressing factor(NKRF),partial

Recombinant Human NF-kappa-B-repressing factor(NKRF),partial

Item no.	CSB-EP015836HU-100
Manufacturer	Cusabio
Amount	100ug
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Category	Neuroscience Neuroinflammation Metabolism Diabetes Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Areas	Cell Biology
Uniprot ID	O15226
Gene Names	NKRF
Organism	Homo sapiens (Human)
AA Sequence	ILQMAEGIDIGEMPSYDLVLSKPSKGQKRHLSTCD GQNPPKKQAGSKFHARPRFEPVHFVASSSKDERQE DPYGPQTKEVNEQTHFASMPRDIYQDYTQDSFSIQ DGNSQYCDSSGFILTKDQPVTANMYFDSGNPAPST TSQQANSQSTPEPSPSQTFPESVVAEKQYFIEKLT ATIWKNLSNPEMTSGSDKINYTYMLTRCIQACKTN PEYIYAPLKEIPPADIPKNKKLLTDGYACEVRCQN IYLTTGYAGSKNGSRDRATELAVKLLQKRIEVRVV RRKFKHTFGEDLVVCQIGMSSYEFPPALKPPEDLV VLGKDASGQPIFNASAKHWTNFVITENANDAIGIL NNSASFNKMSIEYKYEMMPNRTWRCRVFLQDHCLA EGYGTKKTSKHAAADEALKILQKTQPTYPSVKSSQ CHTGSSPRGSGKKKDIKDLVVYENSSNPVCTLNDT AQFNRMTVEYVYERMTGLRWKCKVILESEVIAEAV GVKKTVKYEAAGEAVKTLKKTQPTVINNLKKGAVE DVISRNEIQGRSAEEAYKQQIKEDNIGNQLLRKMG WTGGGLGKSGEGIREPISVKEQHKREGLGLDVERV NKIAKRDIEQIIRNYARSESHTDLTFSRELTNDER KQIHQIAQKYGLKSKSHGVGHDRYLVVGRKRRKED LLDQLKQEGQVGHYELVMPQ
Expression Region	4-688aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	81.1 kDa
Alternative Name(s)	Protein ITBA4Transcription factor NRF
Relevance	Interacts with a specific negative regulatory elent (NRE) 5'-AATTCCTCTGA-3' to mediate transcriptional repression of certain NK-kappa-B responsive genes. Involved in the constitutive silencing of the interferon beta promoter, independently of the virus-induced signals, and in the inhibition of the basal and cytokine-induced iNOS promoter activity. Also involved in the regulation of IL-8 transcription.
Reference	Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Interacts with a specific negative regulatory element (NRE) 5'-AATTCCTCTGA-3' to mediate transcriptional repression of certain NK-kappa-B responsive genes. Involved in the constitutive silencing of the interferon beta promoter, independently of the virus-induced signals, and in the inhibition of the basal and cytokine-induced iNOS promoter activity. Also involved in the regulation of IL-8 transcription.
Subcellular Location	Nucleus, nucleolus
Tissue Specificity	Widely and constitutively expressed. Expressed at lower level in colon, peripheral blood lymphocytes, lung and kidney.
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Request delivery time