Item no. |
CSB-EP015222HUa0-200 |
Manufacturer |
Cusabio
|
Amount |
200ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Purity |
Greater than 85% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Available |
|
Research Topic |
Signal Transduction |
Uniprot ID |
Q02817 |
Gene Names |
MUC2 |
Organism |
Homo sapiens (Human) |
AA Sequence |
VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGS YKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYL TRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSR AGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGL QSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPE EEVAPASCSEHRAECERLLTAEAFADCQDL |
Expression Region |
36-240aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
28.8 kDa |
Alternative Name(s) |
Intestinal mucin-2 (MUC-2) (SMUC) |
Relevance |
Coats the epithelia of the intestines, airways, and other mucus membrane-containing organs. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Major constituent of both the inner and outer mucus layers of the colon and may play a role in excluding bacteria from the inner mucus layer. |
Reference |
"Sulfotransferases of two specificities function in the reconstitution of high endothelial cell ligands for L-selectin." Bistrup A., Bhakta S., Lee J.K., Belov Y.Y., Gunn M.D., Zuo F.-R., Huang C.-C., Kannagi R., Rosen S.D., Hemmerich S. J. Cell Biol. 145:899-910(1999) |
Purity |
Greater than 85% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Coats the epithelia of the intestines, airways, and other mucus membrane-containing organs. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Major constituent of both the inner and outer mucus layers of the colon and may play a role in excluding bacteria from the inner mucus layer. |
Subcellular Location |
Secreted |
Tissue Specificity |
Colon, small intestine, colonic tumors, bronchus, cervix and gall bladder. |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.