« Back
Home /
Recombinant Human Mucin-2(MUC2),partial

Recombinant Human Mucin-2(MUC2),partial

Item no.	CSB-EP015222HUa0-200
Manufacturer	Cusabio
Amount	200ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Topic	Signal Transduction
Uniprot ID	Q02817
Gene Names	MUC2
Organism	Homo sapiens (Human)
AA Sequence	VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGS YKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYL TRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSR AGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGL QSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPE EEVAPASCSEHRAECERLLTAEAFADCQDL
Expression Region	36-240aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	28.8 kDa
Alternative Name(s)	Intestinal mucin-2 (MUC-2) (SMUC)
Relevance	Coats the epithelia of the intestines, airways, and other mucus membrane-containing organs. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Major constituent of both the inner and outer mucus layers of the colon and may play a role in excluding bacteria from the inner mucus layer.
Reference	"Sulfotransferases of two specificities function in the reconstitution of high endothelial cell ligands for L-selectin." Bistrup A., Bhakta S., Lee J.K., Belov Y.Y., Gunn M.D., Zuo F.-R., Huang C.-C., Kannagi R., Rosen S.D., Hemmerich S. J. Cell Biol. 145:899-910(1999)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Coats the epithelia of the intestines, airways, and other mucus membrane-containing organs. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Major constituent of both the inner and outer mucus layers of the colon and may play a role in excluding bacteria from the inner mucus layer.
Subcellular Location	Secreted
Tissue Specificity	Colon, small intestine, colonic tumors, bronchus, cervix and gall bladder.
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time