« Back
Home /
Recombinant Human Malonyl-CoA decarboxylase, mitochondrial(MLYCD)

Recombinant Human Malonyl-CoA decarboxylase, mitochondrial(MLYCD)

Item no.	CSB-EP014646HU-200
Manufacturer	Cusabio
Amount	200ug
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Category	Metabolism Diabetes Cholesterol & Lipid Metabolism Regulation of Appetite Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	Myc
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research areas	others
Target / Protein	O95822
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	O95822
AA Sequence	MDELLRRAVPPTPAYELREKTPAPAEGQCADFVSF YGGLAETAQRAELLGRLARGFGVDHGQVAEQSAGV LHLRQQQREAAVLLQAEDRLRYALVPRYRGLFHHI SKLDGGVRFLVQLRADLLEAQALKLVEGPDVREMN GVLKGMLSEWFSSGFLNLERVTWHSPCEVLQKISE AEAVHPVKNWMDMKRRVGPYRRCYFFSHCSTPGEP LVVLHVALTGDISSNIQAIVKEHPPSETEEKNKIT AAIFYSISLTQQGLQGVELGTFLIKRVVKELQREF PHLGVFSSLSPIPGFTKWLLGLLNSQTKEHGRNEL FTDSECKEISEITGGPINETLKLLLSSSEWVQSEK LVRALQTPLMRLCAWYLYGEKHRGYALNPVANFHL QNGAVLWRINWMADVSLRGITGSCGLMANYRYFLE ETGPNSTSYLGSKIIKASEQVLSLVAQFQKNSKL
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region	40-493AA
Protein length	Full Length of Mature Protein
MW	55.9 kDa
Relevance	Catalyzes the conversion of malonyl-CoA to acetyl-CoA. In the fatty acid biosynthesis MCD selectively removes malonyl-CoA and thus assures that methyl-malonyl-CoA is the only chain elongating substrate for fatty acid synthase and that fatty acids with multiple methyl side chains are produced. In peroxisomes it may be involved in degrading intraperoxisomal malonyl-CoA, which is generated by the peroxisomal beta-oxidation of odd chain-length dicarboxylic fatty acids. Plays a role in the metabolic balance between glucose and lipid oxidation in muscle independent of alterations in insulin signaling. May play a role in controlling the extent of ischemic injury by promoting glucose oxidation.
References	"MCD encodes peroxisomal and cytoplasmic forms of malonyl-CoA decarboxylase and is mutated in malonyl-CoA decarboxylase deficiency." Sacksteder K.A., Morrell J.C., Wanders R.J.A., Matalon R., Gould S.J. J. Biol. Chem. 274:24461-24468(1999)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the conversion of malonyl-CoA to acetyl-CoA. In the fatty acid biosynthesis MCD selectively removes malonyl-CoA and thus assures that methyl-malonyl-CoA is the only chain elongating substrate for fatty acid synthase and that fatty acids with multiple methyl side chains are produced. In peroxisomes it may be involved in degrading intraperoxisomal malonyl-CoA, which is generated by the peroxisomal beta-oxidation of odd chain-length dicarboxylic fatty acids. Plays a role in the metabolic balance between glucose and lipid oxidation in muscle independent of alterations in insulin signaling. May play a role in controlling the extent of ischemic injury by promoting glucose oxidation.
Involvement in disease	Malonyl-CoA decarboxylase deficiency (MLYCD deficiency)
Subcellular Location	Cytoplasm, Mitochondrion matrix, Peroxisome, Peroxisome matrix
Tissue Specificity	Expressed in fibroblasts and hepatoblastoma cells (at protein level). Expressed strongly in heart, liver, skeletal muscle, kidney and pancreas. Expressed in myotubes. Expressed weakly in brain, placenta, spleen, thymus, testis, ovary and small intestine.
Paythway	AMPKSignaling
Tag Information	N-terminal 10xHis-tagged and C-terminal Myc-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time