« Back
Home /
Recombinant Human Tyrosine-protein kinase JAK1(Jak1),partial

Recombinant Human Tyrosine-protein kinase JAK1(Jak1),partial

Item no.	CSB-EP011930HU-1
Manufacturer	Cusabio
Amount	1mg
Category	Oncology Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins By Organ Colorectal Cancer
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Janus kinase 1,Short name:,JAK-1
Available
Research Areas	Cancer
Uniprot ID	P23458
Gene Names	JAK1
Organism	Homo sapiens (Human)
AA Sequence	EQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEG HFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHI ADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKL IMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICK GMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGL TKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFY IASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGP THGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMR KCWEFQPSNRTSFQNLIEGFEALLK
Expression Region	850-1154aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	38.9 kDa
Alternative Name(s)	Janus kinase 1 Short name: JAK-1
Relevance	Tyrosine kinase of the non-receptor type, involved in the IFN-alpha/beta/gamma signal pathway. Kinase partner for the interleukin (IL)-2 receptor. ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.
Reference	Two novel protein-tyrosine kinases, each with a second phosphotransferase-related catalytic domain, define a new class of protein kinase. Wilks A.F., Harpur A.G., Kurban R.R., Ralph S.J., Zuercher G., Ziemiecki A.Mol. Cell. Biol. 11:2057-2065(1991)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Tyrosine kinase of the non-receptor type, involved in the IFN-alpha/beta/gamma signal pathway
Subcellular Location	Endomembrane system, Peripheral membrane protein
Protein Families	Protein kinase superfamily, Tyr protein kinase family, JAK subfamily
Tissue Specificity	Expressed at higher levels in primary colon tumors than in normal colon tissue. The expression level in metastatic colon tumors is comparable to the expression level in normal colon tissue.
Paythway	Jak-STATsignalingpathway
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP011930HU-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time