Item no. |
CSB-EP010737HU-200 |
Manufacturer |
Cusabio
|
Amount |
200ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Short name:H1R,Short name:HH1R |
Available |
|
Research Topic |
Immunology |
Uniprot ID |
P35367 |
Gene Names |
HRH1 |
Organism |
Homo sapiens (Human) |
AA Sequence |
AKIYKAVRQHCQHRELINRSLPSFSEIKLRPENPK GDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTP KEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAE GSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQ MLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLD YIKFTWKRLRSHSRQYVSGLHMNRERKAAKQ |
Expression Region |
211-416aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
27.1 kDa |
Alternative Name(s) |
Short name:H1R Short name:HH1R |
Relevance |
In peripheral tissues, the H1 subclass of histamine receptors mediates the contraction of smooth muscles, increase in capillary permeability due to contraction of terminal venules, and catecholamine release from adrenal medulla, as well as mediating neurotransmission in the central nervous system. |
Reference |
"Molecular cloning of the human histamine H1 receptor gene."Fukui K., Fujimoto K., Mizuguchi H., Sakamoto K., Horio Y., Takai S., Yamada K., Ito S.Biochem. Biophys. Res. Commun. 201:894-901(1994) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
In peripheral tissues, the H1 subclass of histamine receptors mediates the contraction of smooth muscles, increase in capillary permeability due to contraction of terminal venules, and catecholamine release from adrenal medulla, as well as mediating neurotransmission in the central nervous system. |
Subcellular Location |
Cell membrane, Multi-pass membrane protein |
Protein Families |
G-protein coupled receptor 1 family |
Paythway |
Calciumsignalingpathway |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.