Item no. |
CSB-EP010000HU-50 |
Manufacturer |
Cusabio
|
Amount |
50ug |
Quantity options |
1mg
10ug
100ug
20ug
200ug
50ug
500ug
|
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Conjugate/Tag |
GST |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
General transcription factor IIA subunit 2,TFIIA p12 subunit |
Available |
|
Research Topic |
Epigenetics and Nuclear Signaling |
Uniprot ID |
P52657 |
Gene Names |
GTF2A2 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQ VLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDN VWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGS NTTE |
Expression Region |
1-109aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
39.5 kDa |
Alternative Name(s) |
General transcription factor IIA subunit 2 TFIIA p12 subunit |
Relevance |
TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity. |
Reference |
"Reconstitution of human TFIIA activity from recombinant polypeptides: a role in TFIID-mediated transcription." Sun X., Ma D., Sheldon M., Yeung K., Reinberg D. Genes Dev. 8:2336-2348(1994) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity. |
Subcellular Location |
Nucleus |
Protein Families |
TFIIA subunit 2 family |
Tag Information |
N-terminal GST-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.