Item no. |
CSB-EP009666HU-1 |
Manufacturer |
Cusabio
|
Amount |
1mg |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
Human |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Available |
|
Research Areas |
Signal Transduction |
Target / Protein |
GOLM1 |
Biologically Active |
Not Test |
Expression System |
E.coli |
Species of origin |
Homo sapiens (Human) |
Uniprot ID |
Q8NBJ4 |
AA Sequence |
SSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEF QGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAV LVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQ FQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIE EVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRL QAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLD SKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVV EDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEM EGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDD YNMDENEAESETDKQAALAGNDRNIDVFNVEDQKR DTINLLDQREKRNHTL |
Tag Info |
N-terminal 6xHis-tagged |
Expression Region |
36-401aa |
Protein Length |
Partial |
MW |
45.6 kDa |
Alternative Name(s) |
Golgi membrane protein GP73Golgi phosphoprotein 2 |
Relevance |
Unknown. Cellular response protein to viral infection. |
Reference |
GP73, a novel Golgi-localized protein upregulated by viral infection.Kladney R.D., Bulla G.A., Guo L., Mason A.L., Tollefson A.E., Simon D.J., Koutoubi Z., Fimmel C.J.Gene 249:53-65(2000) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Unknown. Cellular response protein to viral infection. |
Subcellular Location |
Golgi apparatus, cis-Golgi network membrane, Single-pass type II membrane protein |
Protein Families |
GOLM1/CASC4 family |
Tissue Specificity |
Widely expressed. Highly expressed in colon, prostate, trachea and stomach. Expressed at lower level in testis, muscle, lymphoid tissues, white blood cells and spleen. Predominantly expressed by cells of the epithelial lineage. Expressed at low level in normal liver. Expression significantly increases in virus (HBV, HCV) infected liver. Expression does not increase in liver disease due to non-viral causes (alcohol-induced liver disease, autoimmune hepatitis). Increased expression in hepatocytes appears to be a general feature of advanced liver disease. In liver tissue from patients with adult giant-cell hepatitis (GCH), it is strongly expressed in hepatocytes-derived syncytial giant cells. Constitutively expressed by biliary epithelial cells but not by hepatocytes. |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.