« Back
Home /
Recombinant Rat Glucagon-like peptide 1 receptor(Glp1r),partial

Recombinant Rat Glucagon-like peptide 1 receptor(Glp1r),partial

Item no.	CSB-EP009514RA-100
Manufacturer	Cusabio
Amount	100ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Host	E.coli
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Alternative Name(s)	Short name: GLP-1 receptor Short name: GLP-1-R Short name: GLP-1R
AA Sequence	GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLL ATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPW ASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSEC EESKQGERNSPEEQLLSLY
Research Topic	Neuroscience
Uniprot ID	P32301
Gene Names	Glp1r
Tag Info	N-terminal 6xHis-tagged
Expression Region	22-145aa
MW of Fusion Proten	18, 3
Sequence Info	Partial
Relevance	This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Reference	"Molecular cloning of a cDNA encoding for the GLP-1 receptor expressed in rat lung."Lankat-Buttgereit B., Goke R., Fehmann H.C., Richter G., Goke B.Exp. Clin. Endocrinol. 102:341-347(1994)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species	Rattus norvegicus (Rat)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Request delivery time