« Back
Home /
Recombinant Human Sperm-egg fusion protein Juno(IZUMO1R)

Recombinant Human Sperm-egg fusion protein Juno(IZUMO1R)

Item no.	CSB-EP008789HU-100
Manufacturer	Cusabio
Amount	100ug
Category	Food Safety Allergenes Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Folate receptor 4,Folate receptor delta,Short name:,FR-delta,IZUMO1 receptor protein JUNO
Available
Research Areas	Developmental Biology
Uniprot ID	A6ND01
Gene Names	IZUMO1R
Organism	Homo sapiens (Human)
AA Sequence	GDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNA CCTLTTSWEAHLDVSPLYNFSLFHCGLLMPGCRKH FIQAICFYECSPNLGPWIQPVGSLGWEVAPSGQGE RVVNVPLCQEDCEEWWEDCRMSYTCKSNWRGGWDW SQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSF KASPERRNSGRCLQKWFEPAQGNPNVAVARLFASS APSWELSYTIMVCSLFLPFLS
Expression Region	20-250aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	30.3 kDa
Alternative Name(s)	Folate receptor 4 Folate receptor delta Short name: FR-delta IZUMO1 receptor protein JUNO
Relevance	Receptor for IZUMO1 present at the cell surface of oocytes (oolemma), which is essential for gamete recognition and fertilization. The IZUMO1:IZUMO1R/JUNO interaction is a necessary adhesion event between sperm and egg that is required for fertilization but is not sufficient for cell fusion. The ligand-receptor interaction probably does not act as a membrane 'fusogen'. Does not bind folate (By similarity).
Reference	Juno is the egg Izumo receptor and is essential for mammalian fertilization.Bianchi E., Doe B., Goulding D., Wright G.J.Nature 508:483-487(2014)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Receptor for IZUMO1 present at the cell surface of oocytes (oolemma), which is essential for species-specific gamete recognition and fertilization. The IZUMO1
Subcellular Location	Cell membrane, Lipid-anchor, GPI-anchor
Protein Families	Folate receptor family
Paythway	Endocytosis
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Request delivery time