« Back
Home /
Recombinant Rat Fibroblast growth factor 23(Fgf23)

Recombinant Rat Fibroblast growth factor 23(Fgf23)

Item no.	CSB-EP008629RA-10
Manufacturer	Cusabio
Amount	10ug
Category	Oncology Metabolism Diabetes Peptides & Proteins Recombinant Proteins By Organ Thyroid Cancer
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research areas	Others
Target / Protein	Fgf23
Biologically active	Not Test
Expression system	E.coli
Species of origin	Rattus norvegicus (Rat)
Uniprot ID	Q8VI82
AA Sequence	YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDG HVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFL CMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLS PKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEV PLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRA TPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDA RRGAGGTDRCRPFPRFV
Tag Info	N-terminal 6xHis-tagged
Expression Region	25-251aa
Protein length	Full Length of Mature Protein
MW	29.5 kDa
Relevance	Regulator of phosphate homeostasis . Inhibits renal tubular phosphate transport by reducing SLC34A1 levels . Regulator of vitamin-D metabolism . Negatively regulates osteoblasts differentiation and matrix mineralization . Acts directly on the parathyroid to decrease PTH secretion. Upregulates EGR1 expression in the presence of KL.
References	Rattus norvegicus fgf23.Itoh N.Klotho converts canonical FGF receptor into a specific receptor for FGF23.Urakawa I., Yamazaki Y., Shimada T., Iijima K., Hasegawa H., Okawa K., Fujita T., Fukumoto S., Yamashita T.Nature 444:770-774(2006)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Regulator of phosphate homeostasis (By similarity). Inhibits renal tubular phosphate transport by reducing SLC34A1 levels (By similarity). Regulator of vitamin-D metabolism (By similarity). Negatively regulates osteoblasts differentiation and matrix mineralization (By similarity). Acts directly on the parathyroid to decrease PTH secretion. Upregulates EGR1 expression in the presence of KL.
Subcellular Location	Secreted
Protein Families	Heparin-binding growth factors family
Tissue Specificity	Expressed in the parathyroid.
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time