Item no. |
CSB-EP007943RA-500 |
Manufacturer |
Cusabio
|
Amount |
500ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Fatty acid-binding protein 3,Heart-type fatty acid-binding protein,Short name:,H-FABP |
Available |
|
Research Topic |
Cardiovascular |
Uniprot ID |
P07483 |
Gene Names |
Fabp3 |
Organism |
Rattus norvegicus (Rat) |
AA Sequence |
ADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASM TKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEF DEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLT RELSDGKLILTLTHGNVVSTRTYEKEA |
Expression Region |
2-133aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
30.6 kDa |
Alternative Name(s) |
Fatty acid-binding protein 3 Heart-type fatty acid-binding protein Short name: H-FABP |
Relevance |
FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. |
Reference |
"Cloning and tissue distribution of rat heart fatty acid binding protein mRNA: identical forms in heart and skeletal muscle."Claffey K.P., Herrera V.L., Brecher P., Ruiz-Opazo N.Biochemistry 26:7900-7904(1987) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. |
Subcellular Location |
Cytoplasm |
Protein Families |
Calycin superfamily, Fatty-acid binding protein (FABP) family |
Tissue Specificity |
Heart, but also skeletal muscle, kidney, brain and mammary gland. |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.