Item no. |
CSB-EP007923HU-50 |
Manufacturer |
Cusabio
|
Amount |
50ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Coagulation factor II,Cleaved into the following 4 chains:,Activation peptide fragment 1,Activation peptide fragment 2,Thrombin light chain,Thrombin heavy chain |
Available |
|
Research Topic |
Cardiovascular |
Uniprot ID |
P00734 |
Gene Names |
F2 |
Organism |
Homo sapiens (Human) |
AA Sequence |
ANTFLEEVRKGNLERECVEETCSYEEAFEALESST ATDVFWAKYTACETARTPRDKLAACLEGNCAEGLG TNYRGHVNITRSGIECQLWRSRYPHKPEINSTTHP GADLQENFCRNPDSSTTGPWCYTTDPTVRRQECSI PVCGQDQVTVAMTPRSEGSSVNLSPPLEQCVPDRG QQYQGRLAVTTHGLPCLAWASAQAKALSKHQDFNS AVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDL NYCEEAVEEETGDGLDEDSDRAIEGRTATSEYQTF FNPRTFGSGEADCGLRPLFEKKSLEDKTERELLES YIDGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGA SLISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGK HSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYK GRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVER PVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDS GGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFY THVFRLKKWIQKVIDQFGE |
Expression Region |
44-622aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
81.3 kDa |
Alternative Name(s) |
Coagulation factor II Cleaved into the following 4 chains: Activation peptide fragment 1 Activation peptide fragment 2 Thrombin light chain Thrombin heavy chain |
Relevance |
Thrombin, which cleaves bonds after Arg and Lys, converts fibrinogen to fibrin and activates factors V, VII, VIII, XIII, and, in complex with thrombomodulin, protein C. Functions in blood homeostasis, inflammation and wound healing. |
Reference |
"Nucleotide sequence of the gene for human prothrombin."Degen S.J.F., Davie E.W.Biochemistry 26:6165-6177(1987) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Thrombin, which cleaves bonds after Arg and Lys, converts fibrinogen to fibrin and activates factors V, VII, VIII, XIII, and, in complex with thrombomodulin, protein C. Functions in blood homeostasis, inflammation and wound healing. |
Involvement in disease |
Factor II deficiency (FA2D); Ischemic stroke (ISCHSTR); Thrombophilia due to thrombin defect (THPH1); Pregnancy loss, recurrent, 2 (RPRGL2) |
Subcellular Location |
Secreted, extracellular space |
Protein Families |
Peptidase S1 family |
Tissue Specificity |
Expressed by the liver and secreted in plasma. |
Paythway |
Regulationofactincytoskeleton |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.