« Back
Home /
Recombinant Pig Erythropoietin(EPO)

Recombinant Pig Erythropoietin(EPO)

Item no.	CSB-EP007743PI-10
Manufacturer	Cusabio
Amount	10ug
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Heart & Blood Cancer
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research areas	Cardiovascular
Target / Protein	EPO
Biologically active	Not Test
Expression system	E.coli
Species of origin	Sus scrofa (Pig)
Uniprot ID	P49157
AA Sequence	APPRLICDSRVLERYILEAKEGENATMGCAESCSF SENITVPDTKVNFYAWKRMEVQQQAMEVWQGLALL SEAILQGQALLANSSQPSEALQLHVDKAVSGLRSL TSLLRALGAQKEAIPLPDASPSSATPLRTFAVDTL CKLFRNYSNFLRGKLTLYTGEACRRRDR
Tag Info	N-terminal 6xHis-B2M-tagged
Expression Region	27-194aa
Protein length	Full Length of Mature Protein
MW	32.6 kDa
Relevance	Erythropoietin is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass.
References	"The porcine erythropoietin gene: cDNA sequence, genomic sequence and expression analyses in piglets." David R.B., Blom A.K., Sjaastad O.V., Harbitz I. Domest. Anim. Endocrinol. 20:137-147(2001)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3.
Subcellular Location	Secreted
Protein Families	EPO/TPO family
Tissue Specificity	Produced by kidney or liver of adult mammals and by liver of fetal or neonatal mammals.
Tag Information	N-terminal 6xHis-B2M-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP007743PI-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time