« Back
Home /
Recombinant Human Ecto-NOX disulfide-thiol exchanger 1(ENOX1)

Recombinant Human Ecto-NOX disulfide-thiol exchanger 1(ENOX1)

Item no.	CSB-EP007676HU-1
Manufacturer	Cusabio
Amount	1mg
Category	Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	Myc
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Areas	Others
Uniprot ID	Q8TC92
Gene Names	ENOX1
Organism	Homo sapiens (Human)
AA Sequence	MVDAGGVENITQLPQELPQMMAAAADGLGSIAIDT TQLNMSVTDPTAWATAMNNLGMVPVGLPGQQLVSD SICVPGFDPSLNMMTGITPINPMIPGLGLVPPPPP TEVAVVKEIIHCKSCTLFPQNPNLPPPSTRERPPG CKTVFVGGLPENATEEIIQEVFEQCGDITAIRKSK KNFCHIRFAEEFMVDKAIYLSGYRMRLGSSTDKKD SGRLHVDFAQARDDFYEWECKQRMRAREERHRRKL EEDRLRPPSPPAIMHYSEHEAALLAEKLKDDSKFS EAITVLLSWIERGEVNRRSANQFYSMVQSANSHVR RLMNEKATHEQEMEEAKENFKNALTGILTQFEQIV AVFNASTRQKAWDHFSKAQRKNIDIWRKHSEELRN AQSEQLMGIRREEEMEMSDDENCDSPTKKMRVDES ALAAQAYALKEENDSLRWQLDAYRNEVELLKQEKE QLFRTEENLTKDQQLQFLQQTMQGMQQQLLTIQEE LNNKKSELEQAKEEQSHTQALLKVLQEQLKGTKEL VETNGHSHEDSNEINVLTVALVNQDRENNIEKRSQ GLKSEKEALLIGIISTFLHVHPFGANIEYLWSYMQ QLDSKISANEIEMLLMRLPRMFKQEFTGVGATLEK RWKLCAFEGIKTT
Expression Region	1-643aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW	80.3 kDa
Alternative Name(s)	Candidate growth-related and time keeping constitutive hydroquinone [NADH] oxidase
Relevance	Probably acts as a terminal oxidase of plasma electron transport from cytosolic NAD(P)H via hydroquinones to acceptors at the cell surface. Hydroquinone oxidase activity alternates with a protein disulfide-thiol interchange/oxidoreductase activity which may control physical membrane displacements associated with vesicle budding or cell enlargement. The activities oscillate with a period length of 24 minutes and play a role in control of the ultradian cellular biological clock.
Reference	Sera from cancer patients contain two oscillating ECTO-NOX activities with different period lengths. Wang S., Morre D.M., Morre D.J. Cancer Lett. 190:135-141(2003)
Purity	Greater than 85% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Probably acts as a terminal oxidase of plasma electron transport from cytosolic NAD(P)H via hydroquinones to acceptors at the cell surface. Hydroquinone oxidase activity alternates with a protein disulfide-thiol interchange/oxidoreductase activity which may control physical membrane displacements associated with vesicle budding or cell enlargement. The activities oscillate with a period length of 24 minutes and play a role in control of the ultradian cellular biological clock.
Subcellular Location	Cell membrane, Secreted, extracellular space
Protein Families	ENOX family
Tissue Specificity	Expressed in lymphocyte cells, breast and breast cancer (at protein level). Found in the sera of cancer patients with a wide variety of cancers including breast, prostate, lung and ovarian cancers, leukemias, and lymphomas. Found also in the serum of healthy volunteers or patients with disorders other than cancer. Probably shed into serum by cancer cells.
Tag Information	N-terminal 10xHis-tagged and C-terminal Myc-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time