Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
500ug |
Host |
E.coli |
Item no. |
CSB-EP007243HU-500 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Alias |
MKP-1-like protein tyrosine phosphatase,Short name:,MKP-L,Mitogen-activated protein kinase phosphatase 6,Short name:,MAP kinase phosphatase 6,Short name:,MKP-6 |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Research Topic |
Signal Transduction |
Uniprot ID |
O95147 |
Gene Names |
DUSP14 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLF LGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQ FEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHG ATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNW VKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQ TPYGIVPDVYEKESRHLMPYWGI |
Expression Region |
1-198aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
38.3 kDa |
Alternative Name(s) |
MKP-1-like protein tyrosine phosphatase Short name: MKP-L Mitogen-activated protein kinase phosphatase 6 Short name: MAP kinase phosphatase 6 Short name: MKP-6 |
Relevance |
Involved in the inactivation of MAP kinases. Dephosphorylates ERK, JNK and p38 MAP-kinases. |
Reference |
"Overproduction, purification and structure determination of human dual-specificity phosphatase 14."Lountos G.T., Tropea J.E., Cherry S., Waugh D.S.Acta Crystallogr. D 65:1013-1020(2009) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.