« Back
Home /
Recombinant Human Dual specificity protein phosphatase 14(DUSP14)

Recombinant Human Dual specificity protein phosphatase 14(DUSP14)

Item no.	CSB-EP007243HU-200
Manufacturer	Cusabio
Amount	200ug
Category	Neuroscience Molecular Targets for Neuroscience Neural Signaling Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 5.1	34160400
ECLASS 6.1	34160400
ECLASS 8.0	42020190
ECLASS 9.0	42020190
ECLASS 10.0.1	32160409
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	MKP-1-like protein tyrosine phosphatase,Short name:,MKP-L,Mitogen-activated protein kinase phosphatase 6,Short name:,MAP kinase phosphatase 6,Short name:,MKP-6
Available
Research Topic	Signal Transduction
Uniprot ID	O95147
Gene Names	DUSP14
Organism	Homo sapiens (Human)
AA Sequence	MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLF LGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQ FEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHG ATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNW VKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQ TPYGIVPDVYEKESRHLMPYWGI
Expression Region	1-198aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	38.3 kDa
Alternative Name(s)	MKP-1-like protein tyrosine phosphatase Short name: MKP-L Mitogen-activated protein kinase phosphatase 6 Short name: MAP kinase phosphatase 6 Short name: MKP-6
Relevance	Involved in the inactivation of MAP kinases. Dephosphorylates ERK, JNK and p38 MAP-kinases.
Reference	"Overproduction, purification and structure determination of human dual-specificity phosphatase 14."Lountos G.T., Tropea J.E., Cherry S., Waugh D.S.Acta Crystallogr. D 65:1013-1020(2009)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP007243HU-200-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time