« Back
Home /
Recombinant Human Docking protein 5(DOK5),partial

Recombinant Human Docking protein 5(DOK5),partial

Item no.	CSB-EP007111HU-10
Manufacturer	Cusabio
Amount	10ug
Category	Oncology Metabolism Diabetes Cholesterol & Lipid Metabolism Regulation of Appetite Peptides & Proteins Recombinant Proteins By Organ Colorectal Cancer
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Downstream of tyrosine kinase 5Insulin receptor substrate 6 ;IRS-6 ;IRS6
Available
Research Topic	Signal Transduction
Uniprot ID	Q9P104
Gene Names	DOK5
Organism	Homo sapiens (Human)
AA Sequence	MECVGTRINDISLGEPDLLATGVEREQSERFNVYL MPSPNLDVHGECALQITYEYICLWDVQNPRVKLIS WPLSALRRYGRDTTWFTFEAGRMCETGEGLFIFQT RDGEAIYQKVHSAALAIAEQHERLLQSVKNSMLQM KMSERAASLSTMVPLPRSAYWQHITRQHSTGQLYR LQDVSSPLKLHRTETFPAYRSEH
Expression Region	1-198aa
Sequence Info	Partial of Isoform 2
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	38.8 kDa
Alternative Name(s)	Downstream of tyrosine kinase 5Insulin receptor substrate 6 ; IRS-6 ; IRS6
Relevance	DOK proteins are enzymatically inert adaptor or scaffolding proteins. They provide a docking platform for the assbly of multimolecular signaling complexes. DOK5 functions in RET-mediated neurite outgrowth and plays a positive role in activation of the MAP kinase pathway. Putative link with downstream effectors of RET in neuronal differentiation.
Reference	The full-ORF clone resource of the German cDNA consortium.Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.BMC Genomics 8:399-399(2007)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	DOK proteins are enzymatically inert adaptor or scaffolding proteins. They provide a docking platform for the assembly of multimolecular signaling complexes. DOK5 functions in RET-mediated neurite outgrowth and plays a positive role in activation of the MAP kinase pathway. Putative link with downstream effectors of RET in neuronal differentiation.
Protein Families	DOK family, Type B subfamily
Tissue Specificity	Highest expression in skeletal muscle, lower in brain, heart and kidney. Also detected in activated peripheral blood T-lymphocytes.
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP007111HU-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time