Item no. |
CSB-EP006392RA-1 |
Manufacturer |
Cusabio
|
Amount |
1mg |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
17-alpha-hydroxyprogesterone aldolase,CYPXVII,Cytochrome P450 17A1,Cytochrome P450-C17,Short name:,Cytochrome P450c17 |
Available |
|
Research Areas |
Metabolism |
Uniprot ID |
P11715 |
Gene Names |
Cyp17a1 |
Organism |
Rattus norvegicus (Rat) |
AA Sequence |
MWELVGLLLLILAYFFWVKSKTPGAKLPRSLPSLP LVGSLPFLPRRGHMHVNFFKLQEKYGPIYSLRLGT TTTVIIGHYQLAREVLIKKGKEFSGRPQMVTQSLL SDQGKGVAFADAGSSWHLHRKLVFSTFSLFKDGQK LEKLICQEAKSLCDMMLAHDKESIDLSTPIFMSVT NIICAICFNISYEKNDPKLTAIKTFTEGIVDATGD RNLVDIFPWLTIFPNKGLEVIKGYAKVRNEVLTGI FEKCREKFDSQSISSLTDILIQAKMNSDNNNSCEG RDPDVFSDRHILATVGDIFGAGIETTTTVLKWILA FLVHNPEVKKKIQKEIDQYVGFSRTPTFNDRSHLL MLEATIREVLRIRPVAPMLIPHKANVDSSIGEFTV PKDTHVVVNLWALHHDENEWDQPDQFMPERFLDPT GSHLITPTQSYLPFGAGPRSCIGEALARQELFVFT ALLLQRFDLDVSDDKQLPRLEGDPKVVFLIDPFKV KITVRQAWMDAQAEVST |
Expression Region |
1-507aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
73.3 kDa |
Alternative Name(s) |
17-alpha-hydroxyprogesterone aldolase CYPXVII Cytochrome P450 17A1 Cytochrome P450-C17 Short name: Cytochrome P450c17 |
Relevance |
Conversion of pregnenolone and progesterone to their 17-alpha-hydroxylated products and subsequently to dehydroepiandrosterone (DHEA) and androstenedione. Catalyzes both the 17-alpha-hydroxylation and the 17, 20-lyase reaction. Involved in sexual development during fetal life and at puberty. |
Reference |
Rat P450(17 alpha) from testis: characterization of a full-length cDNA encoding a unique steroid hydroxylase capable of catalyzing both delta 4- and delta 5-steroid-17, 20-lyase reactions.Fevold H.R., Lorence M.C., McCarthy J.L., Trant J.M., Kagimoto M., Waterman M.R., Mason J.I.Mol. Endocrinol. 3:968-975(1989) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Conversion of pregnenolone and progesterone to their 17-alpha-hydroxylated products and subsequently to dehydroepiandrosterone (DHEA) and androstenedione. Catalyzes both the 17-alpha-hydroxylation and the 17, 20-lyase reaction. Involved in sexual development during fetal life and at puberty. |
Subcellular Location |
Membrane |
Protein Families |
Cytochrome P450 family |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.