« Back
Home /
Recombinant Macaca fascicularis Cathepsin K(CTSK)

Recombinant Macaca fascicularis Cathepsin K(CTSK)

Item no.	CSB-EP006192MOV-500
Manufacturer	Cusabio
Amount	500ug
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Topic	Others
Uniprot ID	P61276
Gene Names	CTSK
Organism	Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
AA Sequence	APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALE GQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTN AFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAA KCRGYREIPEGNEKALKRAVARVGPVSVAIDASLT SFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGN KHWIIKNSWGENWGNKGYILMARNKNNACGIANLA SFPKM
Expression Region	115-329aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	27.5 kDa
Relevance	Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone rodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in Extracellular domain matrix degradation .
Reference	Feild J.A., Brun K.A., McQueney M.S., Amegdazie B.Y.Submitted (JUN-1998)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation (By similarity).
Subcellular Location	Lysosome
Protein Families	Peptidase C1 family
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP006192MOV-500-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500ug

available

Request delivery time