« Back
Home /
Recombinant Mouse Cytoskeleton-associated protein 4(Ckap4),partial

Recombinant Mouse Cytoskeleton-associated protein 4(Ckap4),partial

Item no.	CSB-EP005453MO-500
Manufacturer	Cusabio
Amount	500 ug
Quantity options	1 mg 10 ug 100 ug 200 ug 20 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	Myc, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	VLEEVQQVRRGHQDFSRQRDELGQGLQGVEQKVQS LQATFGTFESLLRNSQHKQDLTEKAVKEGESELNR ISEVLQKLQNEILKDLSDGIHVVKDARERDFTSLE NTVEERLTELTKSINDNIAIFTDVQKRSQKEINEV KMKVASLEESKGDRSQDVKTLKDAVKEVQASMMSR ERDIEALKSSLQTMESDVYTEVRELVSLKQEQQAF KQAADSERLALQALTEKLLRSEESSSRLPEDIRRL EEE
Citations	"Global survey of organ and organelle protein expression in mouse: combined proteomic and transcriptomic profiling." Kislinger T., Cox B., Kannan A., Chung C., Hu P., Ignatchenko A., Scott M.S., Gramolini A.O., Morris Q., Hallett M.T., Rossant J., Hughes T.R., Frey B., Emili A. Cell 125:173-186(2006)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	63-kDa cytoskeleton-linking membrane protein; Short name:; Climp-63; Short name:; p63
Available
Manufacturer - Targets	Ckap4
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	57.6 kDa
General Research Areas	Cancer
Relevance	High-affinity epithelial cell surface receptor for APF. Mediates the anchoring of the endoplasmic reticulum to microtubules.
Expression Region	109-575aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	High-affinity epithelial cell surface receptor for APF.
Subcellular Location	Endoplasmic reticulum membrane, Single-pass type II membrane protein, Cell membrane, Single-pass type II membrane protein, Cytoplasm, cytoskeleton, Cytoplasm, perinuclear region
Biologically active	Not Test
Protein length	Partial

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP005453MO-500-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 2/7/2025