Item no. |
CSB-EP004879HU-10 |
Manufacturer |
Cusabio
|
Amount |
10ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Conjugate/Tag |
GST |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Myeloid cell-specific leucine-rich glycoprotein; CD14 |
Available |
|
Research Topic |
Immunology |
Uniprot ID |
P08571 |
Gene Names |
CD14 |
Organism |
Homo sapiens (Human) |
AA Sequence |
TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSA VEVEIHAGGLNLEPFLKRVDADADPRQYADTVKAL RVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLE DLKITGTMPPLPLEATGLALSSLRLRNVSWATGRS WLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFP ALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLAL RNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRAT VNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKL RVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVP GTALPHEGSMN |
Expression Region |
20-345aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
62.2 kDa |
Alternative Name(s) |
Myeloid cell-specific leucine-rich glycoprotein; CD14 |
Relevance |
In concert with LBP, binds to monomeric lipopolysaccharide and delivers it to the MD-2/TLR4 complex, thereby mediating the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Up-regulates cell surface molecules, including adhesion molecules. |
Reference |
The monocyte differentiation antigen, CD14, is anchored to the cell membrane by a phosphatidylinositol linkage.Haziot A., Chen S., Ferrero E., Low M.G., Silber R., Goyert S.M.J. Immunol. 141:547-552(1988) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Coreceptor for bacterial lipopolysaccharide |
Subcellular Location |
Cell membrane, Lipid-anchor, GPI-anchor, Secreted, Membrane raft, Golgi apparatus |
Tissue Specificity |
Detected on macrophages (at protein level) (PubMed:1698311). Expressed strongly on the surface of monocytes and weakly on the surface of granulocytes; also expressed by most tissue macrophages. |
Paythway |
MAPKsignalingpathway |
Tag Information |
N-terminal GST-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.