« Back
Home /
Recombinant Pig Calpain-2 catalytic subunit(CAPN2)

Recombinant Pig Calpain-2 catalytic subunit(CAPN2)

Item no.	CSB-EP004496PI-10
Manufacturer	Cusabio
Amount	10ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Calcium-activated neutral proteinase 2 ;CANP 2;Calpain M-type;Calpain-2 large subunit;Millimolar-calpain ;M-calpain
Available
Research Topic	Others
Uniprot ID	P43367
Gene Names	CAPN2
Organism	Sus scrofa (Pig)
AA Sequence	YPNTFWMNPQYLIKLEEEDEDQEDGESGCTFLVGL IQKHRRRQRKMGEDMHTIGFGIYEVPEELTGQTNI HLSKNFFLTHRARERSDTFINLREVLNRFKLPPGE YILVPSTFEPNKDGDFCIRVFSEKKADYQVVDDEI EADLEENDASEDDIDDGFRRLFAQLAGEDAEISAF ELQTILRRVLAKRQDIKSDGFSIETCRIMVDMLDS DGSAKLGLKEFYILWTKIQKYQKIYREIDVDRSGT MNSYEMRKALEEAGFKLPCQLHQVIVARFADDQLI IDFDNFVRCLVRLETLFRISKQLDSENTGTIELDL ISWLCFSVL
Expression Region	1-324aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	53.8 kDa
Alternative Name(s)	Calcium-activated neutral proteinase 2 ; CANP 2; Calpain M-type; Calpain-2 large subunit; Millimolar-calpain ; M-calpain
Relevance	Calcium-regulated non-lysosomal thiol-protease which catalyze limited proteolysis of substrates involved in cytoskeletal rodeling and signal transduction. Proteolytically cleaves MYOC at 'Arg-226' .
Reference	Hypoxia-specific upregulation of calpain activity and gene expression in pulmonary artery endothelial cells.Zhang J.L., Patel J.M., Block E.R.Am. J. Physiol. 275:L461-L468(1998)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Calcium-regulated non-lysosomal thiol-protease which catalyzes limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction. Proteolytically cleaves MYOC at 'Arg-226'. Proteolytically cleaves CPEB3 following neuronal stimulation which abolishes CPEB3 translational repressor activity, leading to translation of CPEB3 target mRNAs.
Subcellular Location	Cytoplasm, Cell membrane
Protein Families	Peptidase C2 family
Tissue Specificity	Ubiquitous.
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP004496PI-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time