« Back
Home /
Recombinant Human Carbonic anhydrase-related protein(CA8)

Recombinant Human Carbonic anhydrase-related protein(CA8)

Item no.	CSB-EP004379HU-10
Manufacturer	Cusabio
Amount	10ug
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Carbonic anhydrase VIII
Available
Research Topic	Cancer
Uniprot ID	P35219
Gene Names	CA8
Organism	Homo sapiens (Human)
AA Sequence	MADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGV EWGLVFPDANGEYQSPINLNSREARYDPSLLDVRL SPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLP QGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMEL HLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKE HVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDP LLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQL QIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPL SDRVIRAAFQ
Expression Region	1-290aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	60 kDa
Alternative Name(s)	Carbonic anhydrase VIII
Relevance	Does not have a carbonic anhydrase catalytic activity.
Reference	"The deduced amino acid sequence of human carbonic anhydrase-related protein (CARP) is 98% identical to the mouse homologue." Skaggs L.A., Bergenhem N.C.H., Venta P.J., Tashian R.E. Gene 126:291-292(1993)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Does not have a carbonic anhydrase catalytic activity.
Involvement in disease	Cerebellar ataxia, mental retardation, and dysequilibrium syndrome 3 (CMARQ3)
Protein Families	Alpha-carbonic anhydrase family
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP004379HU-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time