« Back
Home /
Recombinant Human Carbonic anhydrase 2(CA2)

Recombinant Human Carbonic anhydrase 2(CA2)

Item no.	CSB-EP004370HU-1
Manufacturer	Cusabio
Amount	1mg
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Category	Metabolism Diabetes Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Carbonate dehydratase II;Carbonic anhydrase C ;CAC;Carbonic anhydrase II ;CA-II
Available
Research Areas	Signal Transduction
Uniprot ID	P00918
Gene Names	CA2
Organism	Homo sapiens (Human)
AA Sequence	SHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTH TAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFD DSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSE HTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLA VLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFT NFAARGLLPESLDYWTYPGSLTTPPLLECVTWIVL KEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRP AQPLKNRQIKASFK
Expression Region	2-260aa
Sequence Info	Full Length of BC011949
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	45.1 kDa
Alternative Name(s)	Carbonate dehydratase II; Carbonic anhydrase C ; CAC; Carbonic anhydrase II ; CA-II
Relevance	Essential for bone resorption and osteoclast differentiation . Reversible hydration of carbon dioxide. Can hydrate cyanamide to urea. Involved in the regulation of fluid secretion into the anterior chamber of the eye. Contributes to intracellular pH regulation in the duodenal upper villous epithelium during proton-coupled peptide absorption. Stimulates the chloride-bicarbonate exchange activity of SLC26A6.3 Publications
Reference	Nucleotide sequence of human liver carbonic anhydrase II cDNA.Montgomery J.C., Venta P.J., Tashian R.E., Hewett-Emmett D.Nucleic Acids Res. 15:4687-4687(1987)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Essential for bone resorption and osteoclast differentiation (By similarity). Reversible hydration of carbon dioxide. Can hydrate cyanamide to urea. Involved in the regulation of fluid secretion into the anterior chamber of the eye. Contributes to intracellular pH regulation in the duodenal upper villous epithelium during proton-coupled peptide absorption. Stimulates the chloride-bicarbonate exchange activity of SLC26A6.
Involvement in disease	Osteopetrosis, autosomal recessive 3 (OPTB3)
Subcellular Location	Cytoplasm, Cell membrane
Protein Families	Alpha-carbonic anhydrase family
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP004370HU-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time