Item no. |
CSB-EP002658MO-1 |
Manufacturer |
Cusabio
|
Amount |
1mg |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Coiled-coil myosin-like BCL2-interacting protein |
Available |
|
Research Areas |
Epigenetics and Nuclear Signaling |
Uniprot ID |
O88597 |
Gene Names |
Becn1 |
Organism |
Mus musculus (Mouse) |
AA Sequence |
MEGSKASSSTMQVSFVCQRCSQPLKLDTSFKILDR VTIQELTAPLLTTAQAKPGETQEEEANSGEEPFIE TRQDGVSRRFIPPARMMSTESANSFTLIGEASDGG TMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTD TLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDS EQLQRELKELALEEERLIQELEDVEKNRKVVAENL EKVQAEAERLDQEEAQYQREYSEFKRQQLELDDEL KSVENQVRYAQIQLDKLKKTNVFNATFHIWHSGQF GTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHAL ANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLY CSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGE TRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSE EQWTKALKFMLTNLKWGLAWVSSQFYNK |
Expression Region |
1-448aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
67.6 kDa |
Alternative Name(s) |
Coiled-coil myosin-like BCL2-interacting protein |
Relevance |
Plays a central role in autophagy (PubMed:10604474, PubMed:12372286, PubMed:19270693). Acts as core subunit of different PI3K complex forms that mediate formation of phosphatidylinositol 3-phosphate and are believed to play a role in multiple membrane trafficking pathways: PI3KC3-C1 is involved in initiation of autophagosomes and PI3KC3-C2 in maturation of autophagosomes and endocytosis (PubMed:19270693, PubMed:25275521). Involved in regulation of degradative endocytic trafficking and required for the abcission step in cytokinesis, probably in the context of PI3KC3-C2 (By similarity). Essential for the formation of PI3KC3-C2 but not PI3KC3-C1 PI3K complex forms (PubMed:25275521). Involved in endocytosis including endosome formation in neuronal cells (PubMed:25275521). May play a role in antiviral host defense (By similarity). |
Reference |
Beclin 1 is required for neuron viability and regulates endosome pathways via the UVRAG-VPS34 complex.McKnight N.C., Zhong Y., Wold M.S., Gong S., Phillips G.R., Dou Z., Zhao Y., Heintz N., Zong W.X., Yue Z.PLoS Genet. 10:E1004626-E1004626(2014) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Plays a central role in autophagy |
Subcellular Location |
Cytoplasm, Golgi apparatus, trans-Golgi network membrane, Peripheral membrane protein, Endosome membrane, Peripheral membrane protein, Endoplasmic reticulum membrane, Peripheral membrane protein, Mitochondrion membrane, Peripheral membrane protein, Endosome, Cytoplasmic vesicle, autophagosome |
Protein Families |
Beclin family |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.