« Back
Home /
Recombinant Rat Basic leucine zipper transcriptional factor ATF-like 3(Batf3)

Recombinant Rat Basic leucine zipper transcriptional factor ATF-like 3(Batf3)

Item no.	CSB-EP002572RA-100
Manufacturer	Cusabio
Amount	100ug
Category	Oncology Neuroscience Neural Adhesion Molecules Peptides & Proteins Recombinant Proteins By Organ Renal Cancer
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Jun dimerization protein 1 ;JDP-1
Available
Research Areas	Others
Uniprot ID	P97876
Gene Names	Batf3
Organism	Rattus norvegicus (Rat)
AA Sequence	MSQGPPAGGVLQSSVAAPGNQPQSPKDDDRKVRRR EKNRVAAQRSRKKQTQKSDKLHEEHESLEQENSVL RREIAKLKEELRHLTEALKEHEKMCPLLLCPMNFV QLRPDPVASWSAHDAPDHPSFIWLGTLV
Expression Region	1-133aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	19.1 kDa
Alternative Name(s)	Jun dimerization protein 1 ; JDP-1
Relevance	AP-1 family transcription factor that controls the differentiation of CD8+ thymic conventional dendritic cells in the immune syst. Acts via the formation of a heterodimer with JUN family proteins that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3' and regulates expression of target genes. Required for development of CD8-alpha+ classical dendritic cells (cDCs) and related CD103+ dendritic cells that cross-present antigens to CD8 T-cells and produce interleukin-12 (IL12) in response to pathogens .
Reference	Isolation of an AP-1 repressor by a novel method for detecting protein-protein interactions.Aronheim A., Zandi E., Hennemann H., Elledge S.J., Karin M.Mol. Cell. Biol. 17:3094-3102(1997)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	AP-1 family transcription factor that controls the differentiation of CD8(+) thymic conventional dendritic cells in the immune system. Acts via the formation of a heterodimer with JUN family proteins that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3' and regulates expression of target genes. Required for development of CD8-alpha(+) classical dendritic cells (cDCs) and related CD103(+) dendritic cells that cross-present antigens to CD8 T-cells and produce interleukin-12 (IL12) in response to pathogens (By similarity).
Subcellular Location	Nucleus
Protein Families	BZIP family
Tissue Specificity	Ubiquitously expressed.
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Request delivery time