Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
50ug |
Item no. |
CSB-EP002343HUe1-50 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Purity |
Greater than 85% as determined by SDS-PAGE. |
Research areas |
Signal Transduction |
Target / Protein |
ATP4B |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Homo sapiens (Human) |
Uniprot ID |
P51164 |
AA Sequence |
CLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEK GLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQED SINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNC SGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAP RVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPY YGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMA EHVTFNNPHDPYEGKVEFKLKIEK |
Tag Info |
Tag-Free |
Expression Region |
58-291aa |
Protein length |
Extracellular Domain |
MW |
26.6 kDa |
Alternative Name(s) |
Gastric H(+)/K(+) ATPase subunit beta Proton pump beta chain |
Relevance |
Required for stabilization and maturation of the catalytic proton pump alpha subunit and may also involved in cell adhesion and establishing epithelial cell polarity. |
References |
"A C-terminal lobe of the beta subunit of Na, K-ATPase and H, K-ATPase resembles cell adhesion molecules." Bab-Dinitz E., Albeck S., Peleg Y., Brumfeld V., Gottschalk K.E., Karlish S.J. Biochemistry 48:8684-8691(2009) |
Purity |
Greater than 85% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Required for stabilization and maturation of the catalytic proton pump alpha subunit and may also involved in cell adhesion and establishing epithelial cell polarity. |
Subcellular Location |
Cell membrane, Single-pass type II membrane protein |
Protein Families |
X(+)/potassium ATPases subunit beta family |
Paythway |
OxidativePhosphorylation |
Tag Information |
Tag-Free |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.